IGF-1 DES 1 mg (price is per vial)

37.95$
Get cashback $5.69

In stock

Click To Check Quantity Discount

Check the Quantity Discount Below
  • Qty 2 = 2% discount
  • Qty 3 = 4% discount
  • Qty 4 = 6% discount
  • Qty 5 = 8% discount
  • Qty more than 6 = 10% discount

IGF-1 DES is a splice variant of IGF-1 that can be isolated from bovine colostrum, porcine uterus, and human brain. It is estimated to be 10-fold more potent than IGF-1 at stimulating hypertrophy and inducing cultured cells proliferation. Clinical evaluations have shown its potential application in catabolic states and in the management of inflammatory bowel diseases. Please take doctor prescription before taking  IGF-1 injectable and nasal dosage.

Other Names: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Total Amount of the Active Ingredient: 1 mg (1 vial)

Top Color: Blue

Shelf Life: 36 months

Minimum Order: 1 vial

Peptides are stable at room temperature and can be kept in their initial packaging for several days to weeks. Otherwise, peptides can be stored at 4 °C or colder. To preserve product quality, keep away from intense light.

Peptides shouldn’t be shaken before or after reconstitution, must be refrigerated, and always handled with care.

Click here to buy 10 vials (1 kit) of IGF-1 DES at a discounted price!

IGF-1 DES 1 mg should be reconstituted with bacteriostatic water (BAC).

You can purchase BAC water here:
BAC 10ml 
BAC 20ml 

Shipping
•USA: $5.95(3-7 business days)
•Canada: $24.95 (3-7 business days)
•International: $19.95 (7-14 business days)
•Europe: $24.95 (7-14 business days)
•Middle Eastern: (Egypt, Bahrain, Cyprus, Iran, Iraq, Israel, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Syria, UAE, Yemen, Turkey): $24.95 (7-14 business days

If your shipment was seized (International Orders), we will provide a 50% discount applicable on your next purchase. Please contact us for more information.

Shipping to India is currently not available for this product. 


Product Quality Guarantee

All of our products are lab tested and the results are occasionally published on the website.

You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:

  • Cost of HPLC test
  • Total amount of the order + shipping fee

Download IGF1 DES HPLC Report

Download IGF1 DES MS Report

Click Here To Show Product More Info
Average Rating

4.60

05
(5 Reviews)
5 Star
60%
4 Star
40%
3 Star
0%
2 Star
0%
1 Star
0%
Submit your review

5 Reviews For This Product

  1. 05

    by Baltazar Q.

    Best SARMS, PCT / Peptides site to buy IGF-1 DES in my opinion. Much better than the other online website. Huge collection of products, easy to use, and simple order processing. Lots of payment methods are also there, including Bitcoin, which I haven’t found anywhere else. I really like this site, and I’m surely going to buy IGF-1 DES 1MG dosage from here again.

  2. 05

    by Blake M.

    I just got my first package from SwissChems and I’m very pleased. I’m from the US and I placed an order to buy IGF-1 DES online from the USA recently, after I couldn’t find it on Amazon. Thankfully, everything went smoothly. Easy payments and fast delivery. Tons of capsules, pills, and tablets. One drawback, however, is that they don’t have enough product info. There should be more. But other than that, great site!

  3. 05

    by Hendrix

    Looking for a place to buy IGF-1 DES online? You need to try out SwissChems! Amazing products here, starting from SARMS, capsules, tablets, pills, nasal supplements, injectable peptides, and much more. Great online processing methods too! I highly recommend this site for anyone who is looking for a reliable place to buy IGF-1 DES peptides and SARMS from.

  4. 05

    by GORDON

    I recently purchased this and I have to say this is one of the best IGF DES online. The product is of great quality and has many benefits, like use for growth hormone, but there were some problems in the shipping procedure. The delivery was delayed and I didn’t receive any information about it. However, I did get my package soon after. But I would still say if you want to buy IGF-1 DES-1 online, who should do so from here only.

  5. 05

    by James Johnson

    I recently placed an order to buy IGF-1 LR3 1 mg peptide from here and I am very pleased with my order. I received my package in great condition and all the items came packed safely and securely. The delivery was discreet and it reached fast as well. I was glad that I managed to buy IGF-1 LR3 online from here. This is a great website for other kinds of peptides as well. So even if you’re not looking to specifically buy IGF-1 LR3, you will have many other options. It’s a global site so you can buy peptides uk, usa, Canada, and other places.

IGF1 DES

IGF-1 DES 1 mg (price is per vial)

37.95$
Get cashback $5.69

Add to Cart