IGF-1 LR3 0.1 mg (price is per kit/10 vials), 1 mg

$206.95
Get cashback $31.04

In stock

Click To Check Quantity Discount

Check the Quantity Discount Below
  • Qty 2 = 2% discount
  • Qty 3 = 4% discount
  • Qty 4 = 6% discount
  • Qty 5 = 8% discount
  • Qty more than 6 = 10% discount
Category:

IGF-1 LR3 allows for a number of growth-promoting effects of the growth hormone-insulin-like growth factors otherwise known as IGF. It comprises a family of peptides that play important roles in growth and development of mammals. The long R3 IGF-1 version is importantly more potent than regular IGF-1. Its improved potency is due to the decreased binding of IGF-1 LR3 to all known IGF binding proteins. 

The strongest impact IGF has on the human body is its capacity to cause hyperplasia. In muscle cells, proteins and their cell parts are stimulated. Protein combination is expanded along with amino acid absorption. As a source of energy, IGF-1 activates fat. In lean tissue, IGF keeps insulin from moving glucose across cell layers.

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Molar Mass: 9,111 Da

Other Names: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1

Total Amount of the Active Ingredient: 1 mg

Concentration: 0.1 mg per vial

Top Color: Green

Shelf Life: 36 months

Minimum Order: 1 kit (10 vials) / price is per kit

Peptides are stable at room temperature and can be kept in their initial packaging for several days to weeks. Otherwise, peptides can be stored at 4 °C or colder. To preserve product quality, keep away from intense light.

Peptides shouldn’t be shaken before or after reconstitution, must be refrigerated, and always handled with care.

IGF-1 LR3 0.1 mg should be reconstituted with bacteriostatic water (BAC).

You can purchase BAC water here:
BAC 10ml 
BAC 20ml 

Click here to purchase just 1-9 vials!

Shipping
•USA: $9.95 (3-7 business days)
•Canada: $20.00 (3-7 business days)
•International: $20.00 (7-14 business days)
•Europe: $20.00 (7-14 business days)
•Middle Eastern: (Egypt, Bahrain, Cyprus, Iran, Iraq, Israel, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Syria, UAE, Yemen, Turkey): $20.00 (7-14 business days)

If your shipment was seized (International Orders), we will provide a 50% discount applicable on your next purchase. Please contact us for more information.

Enjoy these shipping rates for up to 10 kits!


Product Quality Guarantee

All of our products are lab tested and the results are occasionally published on the website.

You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:

  • Cost of HPLC test
  • Total amount of the order + shipping fee

Download IGF-1 Lr3 HPLC Report

Download IGF-1 Lr3 MS Report

Average Rating

5.00

03
(3 Reviews)
5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%
Submit your review

3 Reviews For This Product

  1. 03

    by Nick

    Very legit source of IGF.

  2. 03

    by Charles M.

    This is more potent than the regular IGF-1. helped me a lot to burn fat, and builds up physical endurance.

  3. 03

    by Carlson

    definitely worth the price and very potent of all. Fast shipping!

Select your currency
USD United States (US) dollar
EUR Euro
IGF-1 Lr3

IGF-1 LR3 0.1 mg (price is per kit/10 vials), 1 mg

$206.95
Get cashback $31.04

Add to Cart