IGF-1 LR3 allows for a number of growth-promoting effects of the growth hormone-insulin-like growth factors otherwise known as IGF. It comprises a family of peptides that play important roles in growth and development of mammals. The long R3 IGF-1 version is importantly more potent than regular IGF-1. Its improved potency is due to the decreased binding of IGF-1 LR3 to all known IGF binding proteins. You can take IGF-1 LR3 in injectable, powder, nasal form please take doctor prescription for IGF-1 LR3 dosage.
The strongest impact IGF has on the human body is its capacity to cause hyperplasia. In muscle cells, proteins and their cell parts are stimulated. Protein combination is expanded along with amino acid absorption. As a source of energy, IGF-1 activates fat. In lean tissue, IGF keeps insulin from moving glucose across cell layers.
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Other Names: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1
Total Amount of the Active Ingredient: 1 mg (1 vial)
Top Color: Green/Red
Shelf Life: 36 months
Minimum Order: 1 vial
Peptides are stable at room temperature and can be kept in their initial packaging for several days to weeks. Otherwise, peptides can be stored at 4 °C or colder. To preserve product quality, keep away from intense light.
Peptides shouldn’t be shaken before or after reconstitution, must be refrigerated, and always handled with care.
Click here to buy 10 vials (1 kit) at a discounted price!
IGF-1 LR3 1 mg has to be reconstituted with bacteriostatic water (BAC).
You can purchase BAC water here:
BAC 10ml
BAC 20ml
Shipping:
•USA: $5.95(3-7 business days)
•Canada: $24.95 (3-7 business days)
•International: $19.95 (7-14 business days)
•Europe: $24.95 (7-14 business days)
•Middle Eastern: (Egypt, Bahrain, Cyprus, Iran, Iraq, Israel, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Syria, UAE, Yemen, Turkey): $24.95 (7-14 business days
If your shipment was seized (International Orders), we will provide a 50% discount applicable on your next purchase. Please contact us for more information.
Shipping to India is currently not available for this product.
Product Quality Guarantee
All of our products are lab tested and the results are occasionally published on the website.
You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:
- Cost of HPLC test
- Total amount of the order + shipping fee
Attachments
Product bundles

IGF-1 LR3 1 mg (price is per vial)
72.95$Get cashback $10.94 +

Bacteriostatic Water (BAC) 10ml
8.95$Get cashback $10.94
Back water bundle

IGF-1 LR3 1 mg (price is per vial)
72.95$Get cashback $10.94 +

Nasal Spray Bottle 10ml
3.95$Get cashback $10.94
Nasal Spray bundle

IGF-1 LR3 1 mg (price is per vial)
72.95$Get cashback $10.94 +

Bacteriostatic Water (BAC) 10ml
8.95$Get cashback $10.94 +

Nasal Spray Bottle 10ml
3.95$Get cashback $10.94
Peptide + BAC water + Nasal Spray product bundle
by Baltazar Q.
I was recommended this site by a fellow gym buddy of mine and I’m so surprised. They have such a Wowza collection of SARMS and research chemicals. I had just placed an order to buy IGF-1 LR3 1mg peptide and it came to me in no time! In great condition, and it was well-packaged. I loved it! They even had Bitcoin payment options!
by Baltazar Q.
If you want to buy IGF-1 LR3 US, then SwissChems is the best site, hands down. They have an excellent selection of capsules and pills, unlike any other site. Other than being a great place to buy IGF-1 LR3 online, you can get many kinds of SARMS, peptides, and tablets you’re looking for here. They’re excellent for ordering from the USA online. The only problem that you might face is their customer service tends to be a bit slow, at least in my case it was. But the delivery and everything was great.
by Wayne
I’ve been looking to buy IGF-1 LR3 1mg for a long time and I even looked at Amazon but I could find none. Then I came across this site and loved it. They have a standout collection of SARMS, capsules, tablets, pills, nasal supplements, injectable peptides, and of all different dosages. It’s a must-see! Their order processing is smooth and easy to handle as well. For beginners who haven’t purchased before, this site will take away all your doubts.
by Daniel
I recently placed an order to buy IGF-1 LR3 1 mg peptide from here and I am very pleased with my order. I received my package in great condition and all the items came packed safely and securely. The delivery was discreet and it reached fast as well. I was glad that I managed to buy IGF-1 LR3 online from here. This is a great website for other kinds of peptides as well. So even if you’re not looking to specifically buy IGF-1 LR3, you will have many other options. It’s a global site so you can buy peptides in uk, usa, Canada, and other places.