IGF-1 LR3 1 mg (price is per vial)

$72.95
Get cashback $10.94

Out of stock

Category: Tag:

IGF-1 LR3 allows for a number of growth-promoting effects of the growth hormone-insulin-like growth factors otherwise known as IGF. It comprises a family of peptides that play important roles in growth and development of mammals. The long R3 IGF-1 version is importantly more potent than regular IGF-1. Its improved potency is due to the decreased binding of IGF-1 LR3 to all known IGF binding proteins. 

The strongest impact IGF has on the human body is its capacity to cause hyperplasia. In muscle cells, proteins and their cell parts are stimulated. Protein combination is expanded along with amino acid absorption. As a source of energy, IGF-1 activates fat. In lean tissue, IGF keeps insulin from moving glucose across cell layers.

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Molar Mass: 9,111 Da

Other Names: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1

Total Amount of the Active Ingredient: 1 mg (1 vial)

Top Color: Green/Red

Shelf Life: 36 months

Minimum Order: 1 vial

Peptides are stable at room temperature and can be kept in their initial packaging for several days to weeks. Otherwise, peptides can be stored at 4 °C or colder. To preserve product quality, keep away from intense light.

Peptides shouldn’t be shaken before or after reconstitution, must be refrigerated, and always handled with care.

Click here to buy 10 vials (1 kit) at a discounted price!

IGF-1 LR3 1 mg has to be reconstituted with bacteriostatic water (BAC).

You can purchase BAC water here:
BAC 10ml 
BAC 20ml 

Shipping
•USA: $5.95(3-7 business days)
•Canada: $24.95 (3-7 business days)
•International: $19.95 (7-14 business days)
•Europe: $24.95 (7-14 business days)
•Middle Eastern: (Egypt, Bahrain, Cyprus, Iran, Iraq, Israel, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Syria, UAE, Yemen, Turkey): $24.95 (7-14 business days

If your shipment was seized (International Orders), we will provide a 50% discount applicable on your next purchase. Please contact us for more information.

Shipping to India is currently not available for this product. 


Product Quality Guarantee

All of our products are lab tested and the results are occasionally published on the website.

You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:

  • Cost of HPLC test
  • Total amount of the order + shipping fee

Attachments

Average Rating

4.50

04
(4 Reviews)
5 Star
50%
4 Star
50%
3 Star
0%
2 Star
0%
1 Star
0%
Submit your review

4 Reviews For This Product

  1. 04

    by Baltazar Q.

    I will order for of these, I found it very effective with less sides and symptoms. fast shipping too.

  2. 04

    by Baltazar Q.

    I found it very effective with fewer sides and symptoms. fast shipping too.

  3. 04

    by Wayne

    Yeah, this is better of a version of what I’ve tried before. This is of good quality. Let us see the result after 3 cycles of my research.

  4. 04

    by Daniel

    I recently placed an order to buy IGF-1 LR3 1 mg peptide from here and I am very pleased with my order. I received my package in great condition and all the items came packed safely and securely. The delivery was discreet and it reached fast as well. I was glad that I managed to buy IGF-1 LR3 online from here. This is a great website for other kinds of peptides as well. So even if you’re not looking to specifically buy IGF-1 LR3, you will have many other options. It’s a global site so you can buy peptides in uk, usa, Canada, and other places.

Select your currency
USD United States (US) dollar
EUR Euro
GHRP-6 5mg

IGF-1 LR3 1 mg (price is per vial)

$72.95
Get cashback $10.94

Add to Cart