Your Cart

Call us: +1 (870) 533-5581

Free shipping on all orders over $100 (US) and $300 (International)

Share

Myostatin 1 mg (1 vial)

$87.99

177 in stock

This item is selling fast!

Free shipping on all orders over $100 (US) and $300 (International)

Guaranteed Safe Checkout:

“SwissChems Payment Methods

Properties

  • Molecular Mass: 42750
  • Synonyms: Growth/differentiation factor 8, GDF-8, MSTN
  • Sequence: MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
  • Total Amount of the Active Ingredient: 1 mg (1 vial)
  • Shelf Life: 36 months

Description 

  • Synthesized myostatin is the lab version of the protein myostatin, a naturally occurring hormone produced by muscle cells that regulates muscle differentiation and growth. According to research, it is a strong therapy candidate for conditions such as muscle wasting or atrophy to stimulate muscle growth.

 

Product Quality

All of our products are lab tested and the results are occasionally published on the website.

You can have the product you bought from us tested at any HPLC-licensed testing facility and if the results are negative, we will refund the following:

  • Cost of HPLC test
  • Total amount of the order + shipping fee

All of our products are lab tested and the results are periodically published on the website.

 

Peer-Reviewed Studies 

Wehling, M., Cai, B., & Tidball, J. G. (2000). The FASEB Journal, 14(1), 103-110.

Impact of resistance loading on myostatin expression and cell cycle regulation in young and older men and women.

  • Kim, J. S., Cross, J. M., & Bamman, M. M. (2005). American Journal of Physiology-Endocrinology and Metabolism, 288(6), E1110-E1119.
Select your currency
USD United States (US) dollar
EUR Euro