FREE Shipping Orders Over $100 For US & $300 For International
0
$0.00 0 items

No products in the cart.

0
$0.00 0 items

No products in the cart.

Myostatin 1 mg (1 vial)

Brand: 
SKU: MYOSTTN-1M

$63.95

142 in stock

Categories: 

Description

Properties

  • Molecular Mass: 42750
  • Synonyms: Growth/differentiation factor 8, GDF-8, MSTN
  • Sequence: MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
  • Total Amount of the Active Ingredient: 1 mg (1 vial)
  • Shelf Life: 36 months

Description 

  • Myostatin is a protein that inhibits myogenesis or the formation of tissues and differentiation and development of cells in the muscles. It is responsible for the control and maintenance of skeletal muscle mass.

 

Product Quality

All of our products are lab tested and the results are occasionally published on the website.

You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:

  • Cost of HPLC test
  • Total amount of the order + shipping fee

All of our products are lab tested and the results are periodically published on the website.

 

Peer-Reviewed Studies 

Wehling, M., Cai, B., & Tidball, J. G. (2000). The FASEB Journal, 14(1), 103-110.

Impact of resistance loading on myostatin expression and cell cycle regulation in young and older men and women.

  • Kim, J. S., Cross, J. M., & Bamman, M. M. (2005). American Journal of Physiology-Endocrinology and Metabolism, 288(6), E1110-E1119.

Shipping

  • USA
  • Canada 
  • Europe 
  • South Asia (Afghanistan, Bangladesh, Bhutan, India, Maldives, Nepal, Pakistan, Sri Lanka)
  • Middle Eastern (Egypt, Bahrain, Cyprus, Iran, Iraq, Israel, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Syria, UAE, Yemen, Turkey)
  • If your shipment was seized (International Orders), we will provide a 50% discount applicable on your next purchase. Please contact us for more information.
    For more information please check out our SHIPPING POLICY & SHIPPING FAQ

 

Disclaimer 

The information provided above is not intended to substitute medical advice, diagnosis, or treatment. Should you have any questions regarding a medical condition, seek the advice of your physician or a qualified healthcare provider. In no case should medical advice be disregarded or delayed because of what you have read or seen. We bear no responsibility or liability for your use of any of our research compounds and products. Please note that they are being sold for research purposes ONLY as indicated here. We do NOT condone any personal use.

NOTE: In some cases wherein the assigned top colors are out of stock, a different top color will be used to ensure that your order will not be delayed. Should you need assistance identifying the Peptide vial that you received, please send us an email at [email protected] or by chatting with us.

 

©SwissChems. All Rights Reserved

menuchevron-down